- Recombinant Erwinia tasmaniensis UPF0756 membrane protein ETA_17460 (ETA_17460)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1078454
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 15,631 Da
- E Coli or Yeast
- 1-148
- UPF0756 membrane protein ETA_17460 (ETA_17460)
Sequence
MFDLTLAIMLFLAALSYFSHNITVTIALLVLIVIRMTPLQQTFPWIEKQGMTVGIIILTIGVMAPIASGTIPSSTLMHSFLHWKSLTAIAIGIFVSWLGGRGVTLMSTQPTVVGGLLIGTIIGVSLFRGVPVGPLIAAGLLSLMLGKG